Protein Info for EX28DRAFT_4410 in Enterobacter asburiae PDN3

Annotation: methionine repressor, MetJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF01340: MetJ" amino acids 3 to 99 (97 residues), 195.5 bits, see alignment E=5e-63

Best Hits

Swiss-Prot: 98% identical to METJ_CITK8: Met repressor (metJ) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K03764, transcriptional repressor of met regulon (beta-ribbon, MetJ family) (inferred from 92% identity to ype:YPO0114)

Predicted SEED Role

"Methionine repressor MetJ" in subsystem Methionine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (105 amino acids)

>EX28DRAFT_4410 methionine repressor, MetJ (Enterobacter asburiae PDN3)
MAEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCE
AFLHAFTGQPLPNDEDLRKERSDEIPEEAKVIMRELGIDPETWEY