Protein Info for EX28DRAFT_4408 in Enterobacter asburiae PDN3

Annotation: replication restart DNA helicase PriA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 731 PF17764: PriA_3primeBD" amino acids 6 to 100 (95 residues), 110.2 bits, see alignment E=1.3e-35 PF21213: PriA-like_WH" amino acids 113 to 175 (63 residues), 113.3 bits, see alignment E=1.4e-36 PF04851: ResIII" amino acids 196 to 358 (163 residues), 56.3 bits, see alignment E=1.4e-18 PF00270: DEAD" amino acids 202 to 365 (164 residues), 78.9 bits, see alignment E=1.4e-25 TIGR00595: primosomal protein N'" amino acids 220 to 729 (510 residues), 719.4 bits, see alignment E=1.1e-220 PF18319: PriA_CRR" amino acids 444 to 470 (27 residues), 33.8 bits, see alignment (E = 9e-12) PF00271: Helicase_C" amino acids 504 to 588 (85 residues), 28.6 bits, see alignment E=5e-10 PF18074: PriA_C" amino acids 631 to 728 (98 residues), 69.8 bits, see alignment E=1e-22

Best Hits

Swiss-Prot: 90% identical to PRIA_ECOLI: Primosomal protein N' (priA) from Escherichia coli (strain K12)

KEGG orthology group: K04066, primosomal protein N' (replication factor Y) (superfamily II helicase) [EC: 3.6.4.-] (inferred from 99% identity to enc:ECL_05042)

MetaCyc: 90% identical to primosomal protein N' (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Helicase PriA essential for oriC/DnaA-independent DNA replication" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA-replication

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (731 amino acids)

>EX28DRAFT_4408 replication restart DNA helicase PriA (Enterobacter asburiae PDN3)
MPVAHVALPVPLPRTFDYLLPDSMSAKAGCRVTVPFGKQQRVGIVVSVSDKSELPLNELK
SVVEVLDSEPVYSTSTWRLLLWAADYYHHPIGDVLFHALPIMLRQGKSASHAPMWYWFAT
EQGQAVDINSLKRSQKQQQALAALRQGKIWRHQVDELEVSETALQALRKKGLSELASEAP
ALYDWRESFSVSGDRLRLNTEQATAVGAIHSASDHFSAWLLAGVTGSGKTEVYLSVLENM
LAQGKQALVMVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVI
GTRSSLFTPFKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPAL
ETLHNVRQRKYHMLRLTRRAGNARPAIQHVLDLKGQQVQAGLAPALITRMRQHLQAGNQV
ILFLNRRGFAPALLCHDCGWIAECPRCDHYYTFHQAQRHLRCHHCDSQRPVPRQCPSCGS
THIVPVGLGTEQLEQALGPFFPDVPISRIDRDTTSRKGALEQQLAEVHRGGARILIGTQM
LAKGHHFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHHP
EHPLLQTLLHKGYDAFAEQALAERQTMQLPPWTSHVIIRAEDHNNQQAPLFLQQLRNLLQ
ASPLVDNQLWILGPVPALAPKRGGRFRWQILLQHPSRVRLQHIVSGTLALINTLPEARKV
KWVLDVDPIEG