Protein Info for EX28DRAFT_4403 in Enterobacter asburiae PDN3

Annotation: 1,4-dihydroxy-2-naphthoate prenyltransferase (EC 2.5.1.74)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 19 to 36 (18 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details amino acids 287 to 305 (19 residues), see Phobius details TIGR00751: 1,4-dihydroxy-2-naphthoate octaprenyltransferase" amino acids 15 to 298 (284 residues), 469.5 bits, see alignment E=2.1e-145 PF01040: UbiA" amino acids 24 to 269 (246 residues), 107.1 bits, see alignment E=4.7e-35

Best Hits

Swiss-Prot: 89% identical to MENA_ECOLI: 1,4-dihydroxy-2-naphthoate octaprenyltransferase (menA) from Escherichia coli (strain K12)

KEGG orthology group: K02548, 1,4-dihydroxy-2-naphthoate octaprenyltransferase [EC: 2.5.1.- 2.5.1.74] (inferred from 97% identity to enc:ECL_05047)

MetaCyc: 89% identical to 1,4-dihydroxy-2-naphthoate octaprenyltransferase (Escherichia coli K-12 substr. MG1655)
DMK-RXN [EC: 2.5.1.74]

Predicted SEED Role

"1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74)" (EC 2.5.1.74)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>EX28DRAFT_4403 1,4-dihydroxy-2-naphthoate prenyltransferase (EC 2.5.1.74) (Enterobacter asburiae PDN3)
MTDISRTQAWLESLRPKTLPLAFAAIIVGTALAWWQGYFDPLVAALALITAGLLQILSNL
ANDYGDAVKGSDKPDRIGPLRGMQKGVITQAQMKRALIITVVLICVSGLALVTVASKTTS
DFIGFLVLGLLAIIAAITYTVGTRPYGYIGLGDISVLVFFGWLSVMGSWYLQAHTVIPAL
FLPATACGLLATAVLNINNLRDIDSDRENGKNTLAVRLGPVNARRYHACLLIGALVCLAL
FNLISLQSLWGWLFVLAAPLLIKQARFVMRELSPSAMPPMLERTVKGALLTNLLFVIGIV
LSQTLR