Protein Info for EX28DRAFT_4393 in Enterobacter asburiae PDN3

Annotation: Di- and tricarboxylate transporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 13 to 40 (28 residues), see Phobius details amino acids 51 to 74 (24 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 189 to 213 (25 residues), see Phobius details amino acids 235 to 252 (18 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 329 to 353 (25 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details amino acids 404 to 428 (25 residues), see Phobius details PF00939: Na_sulph_symp" amino acids 16 to 432 (417 residues), 81.6 bits, see alignment E=6.5e-27 PF03600: CitMHS" amino acids 20 to 370 (351 residues), 92.5 bits, see alignment E=2.8e-30

Best Hits

KEGG orthology group: None (inferred from 96% identity to enc:ECL_05058)

Predicted SEED Role

"Arsenic efflux pump protein" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>EX28DRAFT_4393 Di- and tricarboxylate transporters (Enterobacter asburiae PDN3)
MSLWLTHPLLLPSLIVGVTIVLWATSLLPEFITALMFFTAAMTARIAPPEVIFGGFASSA
FWLVFSGFVLGVAIRKTGLADRAARALSAKLTDSWVLMVASVVLLSYALAFVMPSNMGRI
ALLMPIVAAMAKRAGIADGSRAWYGLALAVGFGTFQLSATILPANVPNLVMSGAAEGSYG
IHLNYVPYLLLHTPVLGILKGLILIGLICWLFPGSPKPPKEQAPSEPMGRDEKRLAWLLA
VVLGMWVTESWHGVGPAWTGLAASIVVMLPRVGFITGEEFSAGVNMRTCIYVAGILGLAI
VVTQTGIGTAVGEALLRIMPLDADRPFTSFLALTGITTALNFIMTANGVPALYTTLAQSF
SDATGFPLLSVIMIQVLGYSTPLLPYQASPIVVAMGLGKVPARAGMVLCLALAIATYLVL
LPLDYLWFSVLGRL