Protein Info for EX28DRAFT_4392 in Enterobacter asburiae PDN3

Annotation: CDP-diacylglycerol diphosphatase, bacterial type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR00672: CDP-diacylglycerol diphosphatase" amino acids 3 to 247 (245 residues), 423 bits, see alignment E=2e-131 PF02611: CDH" amino acids 27 to 245 (219 residues), 295.7 bits, see alignment E=1.1e-92

Best Hits

Swiss-Prot: 99% identical to CDH_ENTCL: CDP-diacylglycerol pyrophosphatase (cdh) from Enterobacter cloacae

KEGG orthology group: K01521, CDP-diacylglycerol pyrophosphatase [EC: 3.6.1.26] (inferred from 95% identity to enc:ECL_05059)

MetaCyc: 71% identical to CDP-diacylglycerol diphosphatase (Escherichia coli K-12 substr. MG1655)
CDP-diacylglycerol diphosphatase. [EC: 3.6.1.26]

Predicted SEED Role

"CDP-diacylglycerol pyrophosphatase (EC 3.6.1.26)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.6.1.26)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>EX28DRAFT_4392 CDP-diacylglycerol diphosphatase, bacterial type (Enterobacter asburiae PDN3)
MKKIILLILIVIALAAGGVYWMKAGNPNALRHIVLDQCVPNQIQNRNPAPCAQVKTDAGY
VVFKDRNGPLQYLLMPTYRINGTESPLLTEAHTPNFFWLAWQSRSFMTLKRGSEVPDSAI
SLTINSPTGRTQNHFHIHISCLRPDVREKLNAAQGEISTQWLPLPGGLEGHEYLARRVTE
NELVQRSPFMMLAEELPEARDHMGRFALAMAQQSDGSFVLLATERNLLTLNRASAEELQD
HQCTILK