Protein Info for EX28DRAFT_4388 in Enterobacter asburiae PDN3

Annotation: P pilus assembly/Cpx signaling pathway, periplasmic inhibitor/zinc-resistance associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 75% identical to CPXP_ECOL6: Periplasmic protein CpxP (cpxP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06006, periplasmic protein CpxP (inferred from 90% identity to enc:ECL_05063)

Predicted SEED Role

"P pilus assembly/Cpx signaling pathway, periplasmic inhibitor/zinc-resistance associated protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>EX28DRAFT_4388 P pilus assembly/Cpx signaling pathway, periplasmic inhibitor/zinc-resistance associated protein (Enterobacter asburiae PDN3)
MRKVTAAVMASTLAFSAFSQAAEAIISDNSPLQEDATQNSSQSHMFDGISLTEHQRQQMR
DLMQRARHDQPPVNVSEMETMHRLVTAENFDESAVRAQAEKMAQEQVARQVELAKVRNQM
FHLLTPEQQAVLNDRHQQRMDQLREVARMQRSSETTFFSSNSSTRSNQ