Protein Info for EX28DRAFT_4379 in Enterobacter asburiae PDN3

Annotation: formate dehydrogenase family accessory protein FdhD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00129: formate dehydrogenase family accessory protein FdhD
  • amino acids 33 to 275 (243 residues), 308.8 bits, E=1.1e-96
• PF02634: FdhD-NarQ
  • amino acids 37 to 274 (238 residues), 233 bits, E=2.2e-73

Best Hits

Swiss-Prot: 82% identical to FDHD_ECO27: Sulfur carrier protein FdhD (fdhD) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: K02379, FdhD protein (inferred from 95% identity to enc:ECL_05088)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• formate oxidation to CO₂ (1/1 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• purine nucleobases degradation II (anaerobic) (13/24 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Protein Sequence (278 amino acids)

>EX28DRAFT_4379 formate dehydrogenase family accessory protein FdhD (Enterobacter asburiae PDN3)
MSKQNRAPHSSPLPAGIVELSVHRPPHITHATPDFLAEEVPVALVYNGISHVVMMASPKD
LELFAIGFSLSEGIIDHPQEIYGMDVVQACNGLEVQIELSSRRFMGLKERRRALAGRTGC
GVCGVEQLNDIGKPVAPLPFTQTFDLARLDHALEHLNDVQPIGQLSGCTHAAAWVLPSGD
IAGGHEDVGRHVALDKLLGRRARESDVWKQGAALVSSRASYEMVQKSAMCGVEILFAVSA
ATTLAVEVAERCNLTLVGFCKPGRATIYTHPQRLIVNQ