Protein Info for EX28DRAFT_4370 in Enterobacter asburiae PDN3

Annotation: thioesterase domain, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 203 to 224 (22 residues), see Phobius details PF00583: Acetyltransf_1" amino acids 15 to 122 (108 residues), 58.3 bits, see alignment E=1.8e-19 PF13673: Acetyltransf_10" amino acids 41 to 128 (88 residues), 45.3 bits, see alignment E=1.7e-15 PF13508: Acetyltransf_7" amino acids 47 to 123 (77 residues), 39.5 bits, see alignment E=1.2e-13 PF09500: YiiD_C" amino acids 158 to 297 (140 residues), 164.3 bits, see alignment E=3.6e-52 TIGR02447: putative thioesterase domain" amino acids 165 to 298 (134 residues), 160.3 bits, see alignment E=1.2e-51

Best Hits

Swiss-Prot: 95% identical to YIID_ECOLI: Uncharacterized protein YiiD (yiiD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to enc:ECL_05097)

Predicted SEED Role

"GNAT family acetyltransferase YiiD potentially involved in tRNA processing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>EX28DRAFT_4370 thioesterase domain, putative (Enterobacter asburiae PDN3)
MYHLRVPQTEEELDAYYQFRWEMLRKPLHQPKGSERDAWDAMAHHQMVMDEEGNLVAVGR
LYINADNEASIRFMAVHPSVQDKGLGTLMAMTLESVARQEGVKRVTCSAREDAVEFFAKL
GFVNQGEITTPQTTPIRHFLMIKPIATLDDILHRADWCGQLQQAWYQHIPLSEKMGVRIQ
QYTGQKFITTMPETGNQNPHHTLFAGSLFSLATLTGWGLIWLMLRERHLGGTIILADAHI
RYSAPISGKPSAVADLGSLGGDLDRLARGRKARVQMQVELFGDKTPGAVFEGTYIVLPAK
PFGAYEEGGNEEE