Protein Info for EX28DRAFT_4345 in Enterobacter asburiae PDN3

Annotation: ribosome biogenesis GTP-binding protein YsxC/EngB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 TIGR03598: ribosome biogenesis GTP-binding protein YsxC" amino acids 10 to 193 (184 residues), 247.8 bits, see alignment E=3.1e-78 PF01926: MMR_HSR1" amino acids 28 to 146 (119 residues), 64.4 bits, see alignment E=1e-21

Best Hits

Swiss-Prot: 91% identical to ENGB_KLEP3: Probable GTP-binding protein EngB (engB) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03978, GTP-binding protein (inferred from 98% identity to enc:ECL_05118)

Predicted SEED Role

"GTP-binding protein EngB" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>EX28DRAFT_4345 ribosome biogenesis GTP-binding protein YsxC/EngB (Enterobacter asburiae PDN3)
MTTWNYQQTHFVTSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPG
RTQMINLFEVAEGKRLVDLPGYGYAQVPEEMKIKWQRALGEYLEKRLCLKGLVVLMDIRH
PLKDLDQQMIDWAVASDIAVLVLLTKADKLASGARKAQVNMVREAVLAFNGDVQVEPFSS
LKKQGVDKLRQKLDTWFSELEPATEAEEE