Protein Info for EX28DRAFT_4341 in Enterobacter asburiae PDN3

Annotation: Protein-disulfide isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13462: Thioredoxin_4
  • amino acids 40 to 177 (138 residues), 41.7 bits, E=1.5e-14
• PF01323: DSBA
  • amino acids 40 to 196 (157 residues), 108.4 bits, E=4.1e-35

Best Hits

Swiss-Prot: 92% identical to DSBA_SALTY: Thiol:disulfide interchange protein DsbA (dsbA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03673, thiol:disulfide interchange protein DsbA (inferred from 96% identity to enc:ECL_05121)

MetaCyc: 84% identical to thiol:disulfide oxidoreductase DsbA (Escherichia coli K-12 substr. MG1655)
RXN-21426 [EC: 1.8.4.15]; 1.8.4.15 [EC: 1.8.4.15]

Predicted SEED Role

"Periplasmic thiol:disulfide interchange protein DsbA" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

MetaCyc Pathways

• periplasmic disulfide bond formation (1/3 steps found)
• cytochrome c biogenesis (system I type) (3/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.15

Protein Sequence (207 amino acids)

>EX28DRAFT_4341 Protein-disulfide isomerase (Enterobacter asburiae PDN3)
MKKIWLALAGMILAFSASAAQFTDGKQYTTLDKPVAGEPQVLEFFSFYCPHCYQFEQVLH
VSDNVKKKLPEGTKMTKYHVEFLGPLGKDLTQAWAVAMALGVEDKITAPMFEAVQKTQTV
QTTADIRKVFVDAGVKGEEYDAAWNSFVVKSLVAQQEKAAADLQLQGVPAMFVNGKYQLN
MQGMDTSSMDIFVQQYADTVKFLVEKK