Protein Info for EX28DRAFT_4320 in Enterobacter asburiae PDN3

Annotation: Sodium Bile acid symporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details PF01758: SBF" amino acids 37 to 76 (40 residues), 30.3 bits, see alignment 1.6e-11 amino acids 70 to 122 (53 residues), 29.8 bits, see alignment E=2.3e-11

Best Hits

Predicted SEED Role

"Sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>EX28DRAFT_4320 Sodium Bile acid symporter family (Enterobacter asburiae PDN3)
MLSAVTRLFPLWALLLSVLAYYTPATFTGIGPWVATLLMLIMFGMGVHLKIDDFKRVLSR
PAPVAAGIFLHYLVIPIALGLVIHHLFPRMVKAVEPYLPAFSMVCILAIISAVVAGSASH
IASVGFVVIIAVVLHNTIGLLGGYWGGKLFGFDESTCRTLAIEVGMQNSGLAAALGKIYF
SPLAALPGALFSVWHNLSGSLLAGYWSGKPIDEQTKKDAVKQG