Protein Info for EX28DRAFT_4307 in Enterobacter asburiae PDN3

Annotation: Maltoporin (phage lambda and maltose receptor)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF02264: LamB" amino acids 29 to 437 (409 residues), 444 bits, see alignment E=4.5e-137

Best Hits

Swiss-Prot: 83% identical to LAMB_ENT38: Maltoporin (lamB) from Enterobacter sp. (strain 638)

KEGG orthology group: K02024, maltoporin (inferred from 90% identity to enc:ECL_00293)

MetaCyc: 78% identical to maltose outer membrane channel / phage lambda receptor protein (Escherichia coli K-12 substr. MG1655)
RXN0-1741; RXN0-1804

Predicted SEED Role

"Maltoporin (maltose/maltodextrin high-affinity receptor, phage lambda receptor protein)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>EX28DRAFT_4307 Maltoporin (phage lambda and maltose receptor) (Enterobacter asburiae PDN3)
MMITLRKQVPLAIAIAAGILSAQAGAVDFKGYARSGIGWTGSGGEQQCFQATGAQSKYRL
GNECETYAELKLGQEVWKEGDKSFYFDTNVAYSVSQQNDWESTSPAFREANVQGKNLIEA
LPGSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGIENIDLGFGKLSLAATRSSEAGGSAT
FADRDAQGNRIYDNLVPNDVFDVRLAQMQVNEGGTLEFGVDYGHTNIPDDYYLQPGASKD
GWMFTAEHTQSMLKGFNKFVLQYATDSMTSNGKGRAEGGSINNNGDMWRVLDHGAISLGD
SWDLMYVGMYQDINLDNNNGTKWWTVGVRPMYKWTPIMSTLLEVGYDNVKSQKTDDTNSQ
YKITLAQQWQAGDSIWSRPAIRVFATYAKWDEKWGYANGDSGAGYDSGIAYSDTSAKTFS
RGDSDEWTFGAQMEIWW