Protein Info for EX28DRAFT_4302 in Enterobacter asburiae PDN3

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 37 to 64 (28 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details PF07947: YhhN" amino acids 26 to 206 (181 residues), 159 bits, see alignment E=5.4e-51

Best Hits

Swiss-Prot: 88% identical to YHHN_ECOLI: Uncharacterized membrane protein YhhN (yhhN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to enc:ECL_04830)

Predicted SEED Role

"probable enzyme yhhN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>EX28DRAFT_4302 Predicted membrane protein (Enterobacter asburiae PDN3)
MLWSFIAVCFSAWLYVDASYRGPTWQRWLFKPVTLLLLLLLAWQAPMFNAVSYLVLAGLC
ASLIGDALTLLPRQRLLYAVGAFFLSHLLYTIYFASQMTLSFFWPLPLVLLVIGALLIAV
IWSRLEEMRLPVCTFIAMTLVMVWLAGELWFFRPTAPAMSAFFGAALLLIGNVVWLGSHY
RRRFRADNAIASACYFAGHFLIVRSLYI