Protein Info for EX28DRAFT_4296 in Enterobacter asburiae PDN3

Annotation: putative protein insertion permease FtsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 71 to 94 (24 residues), see Phobius details amino acids 213 to 240 (28 residues), see Phobius details amino acids 271 to 294 (24 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details TIGR00439: putative protein insertion permease FtsX" amino acids 45 to 350 (306 residues), 515.4 bits, see alignment E=2.5e-159 PF18075: FtsX_ECD" amino acids 109 to 203 (95 residues), 56.3 bits, see alignment E=4e-19 PF02687: FtsX" amino acids 226 to 340 (115 residues), 50 bits, see alignment E=2.9e-17

Best Hits

Swiss-Prot: 91% identical to FTSX_SHIFL: Cell division protein FtsX (ftsX) from Shigella flexneri

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 98% identity to enc:ECL_04824)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>EX28DRAFT_4296 putative protein insertion permease FtsX (Enterobacter asburiae PDN3)
MNKRDAMNQIRQFGNRFDRFRKPQGGGDGNRNAPKRQKAAPKPASRKTNVFNEQVRYAFH
GALQDLKSKPLATFLTVMVIAISLTLPSVCYMVYKNVNQAASQYYPSPQITVYMDKALDD
NAAAQVVGQIQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLPAVAVVIPKLD
FQGTDSLNTLRDRITRIKGIDEVRMDDSWFARLAALTGLVGRVAAMIGVLMVAAVFLVIG
NSVRLSIFARRDTINVQKLIGATDGFILRPFLYGGALLGFSGAFLSLILSEILVMRLSSA
VTEVAQVFGTKFDISGLGFDECLLLLLVCSMIGWVAAWLATVQHLRHFTPD