Protein Info for EX28DRAFT_4290 in Enterobacter asburiae PDN3

Annotation: ABC-type branched-chain amino acid transport systems, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 26 to 346 (321 residues), 187.3 bits, see alignment E=9.2e-59 PF13433: Peripla_BP_5" amino acids 26 to 347 (322 residues), 63.4 bits, see alignment E=3.1e-21 PF01094: ANF_receptor" amino acids 49 to 349 (301 residues), 82.3 bits, see alignment E=5.6e-27

Best Hits

Swiss-Prot: 93% identical to LIVK_ECOLI: Leucine-specific-binding protein (livK) from Escherichia coli (strain K12)

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 98% identity to enc:ECL_04816)

MetaCyc: 93% identical to L-leucine/L-phenylalanine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-35-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"High-affinity leucine-specific transport system, periplasmic binding protein LivK (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>EX28DRAFT_4290 ABC-type branched-chain amino acid transport systems, periplasmic component (Enterobacter asburiae PDN3)
MKRNAKTLIAGMVALSISHAAMADDIKVAVVGAMSGPVAQWGDMEFNGARQAIKDINAKG
GIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMI
TPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILDTVKPQRIAIIHDKQQYGEGLARS
VQDGLKKGGANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQMLRQARATG
LKTQFMGPEGVGNASLSNIAGDSAEGMLVTMPKRYDQDPANKAIVDALKAQKKDPSGPYV
WITYAAVQSLATALDRSGSKEPLDLVKDLKAHGANTVIGPLNWDEKGDLKGFEFGVFKWH
ADGSSSAAK