Protein Info for EX28DRAFT_4289 in Enterobacter asburiae PDN3

Annotation: Branched-chain amino acid ABC-type transport system, permease components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 242 to 270 (29 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 12 to 292 (281 residues), 199.5 bits, see alignment E=3.1e-63

Best Hits

Swiss-Prot: 96% identical to LIVH_SALTY: High-affinity branched-chain amino acid transport system permease protein LivH (livH) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 96% identity to eok:G2583_4158)

MetaCyc: 96% identical to branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>EX28DRAFT_4289 Branched-chain amino acid ABC-type transport system, permease components (Enterobacter asburiae PDN3)
MSEQFLYFLQQMFNGVTLGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVSFMIIAA
LMMMGIDSSWLLVAAGFVGAIVIASAYGWSIERVAYRPVRSSKRLIALISAIGMSIFLQN
YVSLTEGSRDVALPSLFNGQWIVGASENFAATITTMQLVIWVVTFIAMLALTLFIRYSRM
GRACRACAEDLKMASLLGINTDRVIALTFVIGAAMAAVAGVLLGQFYGVINPYIGFMAGM
KAFTAAVLGGIGSIPGAMIGGLILGVAEALSSAYLSTEYKDVVSFALLILVLLVMPTGIL
GRPEVEKV