Protein Info for EX28DRAFT_4278 in Enterobacter asburiae PDN3

Annotation: Acetyltransferases, including N-acetylases of ribosomal proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 4 to 137 (134 residues), 45.5 bits, E=4.6e-15
• PF13420: Acetyltransf_4
  • amino acids 6 to 155 (150 residues), 40.2 bits, E=1.3e-13
• PF00583: Acetyltransf_1
  • amino acids 33 to 136 (104 residues), 67.9 bits, E=3.4e-22
• PF13523: Acetyltransf_8
  • amino acids 35 to 141 (107 residues), 30.7 bits, E=7.9e-11
• PF13673: Acetyltransf_10
  • amino acids 38 to 137 (100 residues), 41.4 bits, E=4.9e-14
• PF13508: Acetyltransf_7
  • amino acids 54 to 137 (84 residues), 38.8 bits, E=3.5e-13

Best Hits

Swiss-Prot: 85% identical to AAAT_ECOLI: L-amino acid N-acetyltransferase AaaT (aaaT) from Escherichia coli (strain K12)

KEGG orthology group: K03825, putative acetyltransferase [EC: 2.3.1.-] (inferred from 99% identity to enc:ECL_04804)

Predicted SEED Role

"Putative acetyltransferase"

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Protein Sequence (162 amino acids)

>EX28DRAFT_4278 Acetyltransferases, including N-acetylases of ribosomal proteins (Enterobacter asburiae PDN3)
MSEIVIRHAEPKDYDAIRQIHAQPEVYHNTLQVPHPSEQMWQERLSDQPGIKQLVACIDG
HVAGHLCIVVAQRPRRSHVADFGICVGAQWQNRGVASALMRTMIDMCDNWLRVDRIELTV
FVDNEPAIAVYKKHGFEIEGTGKRYALRNGEYVDAYYMARMK