Protein Info for EX28DRAFT_4274 in Enterobacter asburiae PDN3

Annotation: transcriptional regulator, LacI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF00356: LacI" amino acids 27 to 71 (45 residues), 66.6 bits, see alignment 2.7e-22 PF00532: Peripla_BP_1" amino acids 83 to 331 (249 residues), 104.6 bits, see alignment E=1.4e-33 PF13407: Peripla_BP_4" amino acids 85 to 293 (209 residues), 47.5 bits, see alignment E=3.5e-16 PF13377: Peripla_BP_3" amino acids 194 to 349 (156 residues), 84.9 bits, see alignment E=1.4e-27

Best Hits

Swiss-Prot: 96% identical to GNTR_ECOLI: HTH-type transcriptional regulator GntR (gntR) from Escherichia coli (strain K12)

KEGG orthology group: K06145, LacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor (inferred from 99% identity to enc:ECL_04801)

Predicted SEED Role

"Gluconate utilization system Gnt-I transcriptional repressor" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>EX28DRAFT_4274 transcriptional regulator, LacI family (Enterobacter asburiae PDN3)
MGFVRDKLSKSLTSRFLRTMKKKRPVLQDVADRVGVTKMTVSRFLRNPEQVSVALRGKIA
AALDELGYIPNRAPDILSNATSRAVGVLLPSLTNQVFAEVLRGIESVTDAFGYQTMLAHY
GYKPELEEERLESMLSWNIDGLILTERTHTARTLKMIEVAGIPVVELMDSQSPCLDIAVG
FDNFEAARQMTAAIIARGHRHIAYLGARLDERTIIKQKGYEQAMLDANLTPYSVMVEQSS
SYTSGIELMRQARREYPQLDGIFCTNDDLAVGAAFECQRLGLKIPDDMAIAGFHGHDIGQ
VMEPRLASVLTPRERMGRIGAERLLARIRGETVTPKMLDLGFTLSPGGSI