Protein Info for EX28DRAFT_4272 in Enterobacter asburiae PDN3

Annotation: gluconate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 102 to 130 (29 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 332 to 351 (20 residues), see Phobius details amino acids 353 to 353 (1 residues), see Phobius details amino acids 356 to 373 (18 residues), see Phobius details amino acids 376 to 377 (2 residues), see Phobius details amino acids 383 to 408 (26 residues), see Phobius details amino acids 423 to 445 (23 residues), see Phobius details TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 4 to 444 (441 residues), 579.6 bits, see alignment E=2.4e-178 PF02447: GntP_permease" amino acids 5 to 441 (437 residues), 549.3 bits, see alignment E=6.4e-169 PF03600: CitMHS" amino acids 18 to 386 (369 residues), 43.7 bits, see alignment E=2e-15

Best Hits

Swiss-Prot: 96% identical to GNTU_ECOLI: Low-affinity gluconate transporter (gntU) from Escherichia coli (strain K12)

KEGG orthology group: K06156, Gnt-I system low-affinity gluconate transporter (inferred from 99% identity to ent:Ent638_3844)

MetaCyc: 96% identical to low-affinity gluconate transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-209

Predicted SEED Role

"Low-affinity gluconate/H+ symporter GntU" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>EX28DRAFT_4272 gluconate transporter (Enterobacter asburiae PDN3)
MSTLTLVLTAVGSVLLLLFLVMKARMHAFVALMVVSIGAGLFSGMPLDKIAATMEKGMGG
TLGFLAIVVALGAMFGEILHETGAVDQIAVKMLKSFGHSRAHYAIGLAGLICALPLFFEV
AVVLLISVAFSMARHTGTNLVKLVIPLFAGVAAAAAFLLPGPAPMLLASQMHADFGWMIL
IGLCAAIPGMIIAGPLWGNFISRYVELHIPDDITEPHLGEGKMPSFGFSLSLILLPLVLV
GLKTIAARFVPVGSSAYEWFEFIGHPFTAILVACLVAIYGLAMRQGMPKDRVMEICGAAL
QPAGIILLVIGAGGVFKQVLVDSGVGPALGEALTGMGLPIAVTCFVLAAAVRIIQGSATV
ACLTAVGLVMPVIEQLNYSGAQMAALSICIAGGSIVVSHVNDAGFWLFGKFTGATEAQTL
KTWTLMETILGTTGAIVGMIAFTLLS