Protein Info for EX28DRAFT_4268 in Enterobacter asburiae PDN3

Annotation: putative efflux protein, MATE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 353 to 375 (23 residues), see Phobius details amino acids 386 to 404 (19 residues), see Phobius details amino acids 410 to 428 (19 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 17 to 410 (394 residues), 333.2 bits, see alignment E=1.1e-103 PF01554: MatE" amino acids 17 to 178 (162 residues), 118.1 bits, see alignment E=1.6e-38 amino acids 241 to 396 (156 residues), 51.5 bits, see alignment E=5e-18

Best Hits

Swiss-Prot: 84% identical to DINF_ECOLI: DNA damage-inducible protein F (dinF) from Escherichia coli (strain K12)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 94% identity to enc:ECL_00302)

Predicted SEED Role

"DNA-damage-inducible protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>EX28DRAFT_4268 putative efflux protein, MATE family (Enterobacter asburiae PDN3)
MSLLTASDKALWRLALPMIFSNITVPLLGLVDTAVIGHLDSPVYLGGVAIGATATSFLFM
LLLFLRMSTTGLTAQAYGAKDPLRLARALVQPLILALGAGALIVLFRTPLIDLALHVVGG
SEAVLAQAQRFLEIRWLSAPASLANLVLLGWLLGVQYARAPVILLVVGNLLNIVLDVWLV
MGLHMNVRGAALATAIAEYGTFIIGLWMVWRVLAMRGISLALLKTAWRGNIRRLLALNRD
IMLRSLLLQLCFGALTVFGARLGPEIVAVNAVLMTLLTFTAYALDGFAYAVEAHSGQAYG
ARESGQLRDVWRAACRQSGLVALAFGLVYACLGEQIVALLTSIPALRELASHYLIWQVIL
PVVGVWCYLLDGMFIGATRGAEMRNSMAVAAAGFGLTLLTLPWLGNHGLWLALAVFLSLR
GISLAFIWHRHWQNDTWFPSRHDIS