Protein Info for EX28DRAFT_4257 in Enterobacter asburiae PDN3

Annotation: Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF00072: Response_reg" amino acids 3 to 110 (108 residues), 30.5 bits, see alignment E=7e-11 PF08281: Sigma70_r4_2" amino acids 140 to 176 (37 residues), 27.8 bits, see alignment 3.1e-10 PF00196: GerE" amino acids 140 to 194 (55 residues), 75.9 bits, see alignment E=3.1e-25

Best Hits

KEGG orthology group: None (inferred from 42% identity to ctu:CTU_05170)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>EX28DRAFT_4257 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain (Enterobacter asburiae PDN3)
MNILMIDELPIFIHGMKTELERVMPECTVFAANNFEDAHAILTSMPVSIILLDGEMKCRD
FITNLMTNWPELPIVVMLRKTTDKIFNFYIRQSIKGIFTKDLPAEKISQILCMVSSGVVC
FPEQAVVQREQPTGGLPIYSLSRRQKEVLKLLANGGTNKQISRQLNISAGTVKVHLESIF
HRLQVNNRTQAAMLYFKYMSN