Protein Info for EX28DRAFT_4238 in Enterobacter asburiae PDN3

Annotation: Na+/H+ antiporter, bacterial form

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 32 to 50 (19 residues), see Phobius details amino acids 56 to 72 (17 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 218 to 235 (18 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 314 to 337 (24 residues), see Phobius details amino acids 361 to 385 (25 residues), see Phobius details amino acids 397 to 420 (24 residues), see Phobius details TIGR00831: Na+/H+ antiporter" amino acids 7 to 546 (540 residues), 812.8 bits, see alignment E=6.2e-249 PF00999: Na_H_Exchanger" amino acids 14 to 421 (408 residues), 241.9 bits, see alignment E=5.3e-76

Best Hits

Swiss-Prot: 94% identical to YJCE_ECOLI: Uncharacterized Na(+)/H(+) exchanger YjcE (yjcE) from Escherichia coli (strain K12)

KEGG orthology group: K03316, monovalent cation:H+ antiporter, CPA1 family (inferred from 99% identity to enc:ECL_00324)

Predicted SEED Role

"Putative Na(+)/H(+) exchanger protein, CPA1 family precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (548 amino acids)

>EX28DRAFT_4238 Na+/H+ antiporter, bacterial form (Enterobacter asburiae PDN3)
MEIFFTILIMTLVVSLSGVVTRVLPFQVPLPLMQIAIGALLAWPTFGLHVEFDPELFLVL
FIPPLLFADGWKTPTREFLEHGREIFGLALALVVVTVVGIGFLIYWAVPGIPLIPAFALA
AVLSPTDAVALSGIVGEGRIPKKIMGILQGEALMNDASGLVALKFAVAVAMGTMVFTVGG
ATLEFFKVAIGGILAGFVVSWLYGRSLRFLSRWGGDEPATQIVLLFLLPFASYLIAEHIG
VSGILAAVAAGMTITRSGVMRRAPLAMRLRANSTWAMLEFVFNGMVFLLLGLQLPGIMES
SLVAAEADPNVEVWMLFTDIVLIYLALMLVRFGWLWTMKRFSVRFLKKKPMEFGSWTTRE
LLIASFAGVRGAITLAGVLSIPLLLPTGDVFPARYELVFLAAGVILFSLFVGVIMLPILL
QHIDAGDSTQQHKEERIARAATAEVAIVAIQKMEERLAADAEENIDNQLLTEVSSRVIGN
LRRRADGRNDVESSLQEENLERRFRLAALRSERAELYHLRATRQISNETLQKLLHDLDLL
EALLIENQ