Protein Info for EX28DRAFT_4230 in Enterobacter asburiae PDN3

Annotation: Sel1 repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF08238: Sel1" amino acids 33 to 64 (32 residues), 10.1 bits, see alignment 0.00022 amino acids 138 to 170 (33 residues), 22.4 bits, see alignment 2.8e-08 amino acids 175 to 210 (36 residues), 22.3 bits, see alignment 3.2e-08

Best Hits

Swiss-Prot: 63% identical to YJCO_SHIFL: Uncharacterized protein YjcO (yjcO) from Shigella flexneri

KEGG orthology group: K07126, (no description) (inferred from 92% identity to enc:ECL_00332)

Predicted SEED Role

"FIG01200701: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>EX28DRAFT_4230 Sel1 repeat (Enterobacter asburiae PDN3)
MKHIFLLLLLFTSLVRADEIGSQYKEQAEAGDARAQYYLADTYFSSGDSKQAALWAEKAA
KGGDVDAMGLLSQILFTQGNYAQAKALAQQATIAGSKRGAIMLARVLVNTQAGKTDYPQA
IKLLQTAAEDIDNDSAVDAQMLLGLIYANGVEVAQDDVQAASWFKRSSALSRTGYAEYWA
GMLFRQGEKGFITPNKQKALYWLNLSCTEGFDTGCEEFDALSGE