Protein Info for EX28DRAFT_4212 in Enterobacter asburiae PDN3

Annotation: Acetyltransferase (GNAT) family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 PF00583: Acetyltransf_1" amino acids 18 to 133 (116 residues), 64.2 bits, see alignment E=2.1e-21 PF13673: Acetyltransf_10" amino acids 27 to 136 (110 residues), 35.9 bits, see alignment E=1e-12 PF13508: Acetyltransf_7" amino acids 50 to 134 (85 residues), 49.3 bits, see alignment E=8.2e-17

Best Hits

Swiss-Prot: 78% identical to PHNO_ECOLI: Aminoalkylphosphonate N-acetyltransferase (phnO) from Escherichia coli (strain K12)

KEGG orthology group: K09994, PhnO protein [EC: 2.3.1.-] (inferred from 92% identity to enc:ECL_00350)

MetaCyc: 78% identical to aminoalkylphosphonate N-acetyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-17960 [EC: 2.3.1.280]; 2.3.1.280 [EC: 2.3.1.280]; 2.3.1.280 [EC: 2.3.1.280]; 2.3.1.280 [EC: 2.3.1.280]; 2.3.1.- [EC: 2.3.1.280]

Predicted SEED Role

"PhnO protein" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.280

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>EX28DRAFT_4212 Acetyltransferase (GNAT) family (Enterobacter asburiae PDN3)
MPDCQLRPATADDAQIVYALICELKQAEFDHQAFHAGFLANLQDRNMRYQLAEREGQVIG
MIGLHMQFHLHHARWIGEIQELVVMPQARGLKVGSQLLAWAEEVARQAGAELTELSTSVK
RTDAHRFYVREGYTQSHFRFTKPL