Protein Info for EX28DRAFT_4193 in Enterobacter asburiae PDN3

Annotation: ABC-type uncharacterized transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 129 to 156 (28 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 259 to 285 (27 residues), see Phobius details amino acids 305 to 329 (25 residues), see Phobius details PF03824: NicO" amino acids 93 to 209 (117 residues), 51 bits, see alignment E=6.8e-18 amino acids 228 to 326 (99 residues), 27.7 bits, see alignment E=8.4e-11

Best Hits

KEGG orthology group: None (inferred from 91% identity to enc:ECL_00369)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>EX28DRAFT_4193 ABC-type uncharacterized transport system, permease component (Enterobacter asburiae PDN3)
MRSHELSEKINYTSGKYSPLCRPTLMTTQRLARDWRLPTAGVMLLALLFAVFTLHAHWNA
FIQWCLATQITLHRYLVMYLLQLNNHQYSGGLWLLTGAFLYGVLHAIGPGHGKFIVTTYL
TTNKESELAARVVPFLGSLMQGVSAILFVFILAVGFNLASGDISTSRWYVEKISAVLIGA
FGAFVIYQALKSLHPRRMSISAIKPLHQHDEHCGCGHHGVGTDLTQGDWKTRLGVILAVG
ARPCSGAIMILMFSNALGIVTWGVAAVMTMSLGTALSIVGLSLAVRYARERTVTWFGESA
SLRWLVPAVKIAGGVVLILFATVLFLTVIPISANGDYIAAGC