Protein Info for EX28DRAFT_4186 in Enterobacter asburiae PDN3

Annotation: sulfur relay protein TusC/DsrF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF02635: DsrE" amino acids 2 to 119 (118 residues), 113.4 bits, see alignment E=3.4e-37 TIGR03010: sulfur relay protein TusC/DsrF" amino acids 4 to 119 (116 residues), 164.6 bits, see alignment E=3.8e-53

Best Hits

Swiss-Prot: 79% identical to TUSC_ENT38: Protein TusC (tusC) from Enterobacter sp. (strain 638)

KEGG orthology group: K07236, tRNA 2-thiouridine synthesizing protein C (inferred from 92% identity to enc:ECL_04709)

MetaCyc: 67% identical to sulfurtransferase complex subunit TusC (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusC"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (119 amino acids)

>EX28DRAFT_4186 sulfur relay protein TusC/DsrF (Enterobacter asburiae PDN3)
MKRVAFVFTSAPHGNASGREGLDALLATSALTEDIGVFFLGDGVFQLLAGQQPQAILARD
YIATFKVLPLYDIETFYVCADSLAARGLNEATPFVLDVTVLSSAALREHLSHYDTVLTF