Protein Info for EX28DRAFT_4150 in Enterobacter asburiae PDN3

Annotation: Protein of unknown function (DUF2531)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF10748: HofP" amino acids 5 to 134 (130 residues), 126.7 bits, see alignment E=2.6e-41

Best Hits

Swiss-Prot: 46% identical to HOFP_ECOLI: DNA utilization protein HofP (hofP) from Escherichia coli (strain K12)

KEGG orthology group: K12291, pilus assembly protein HofP (inferred from 72% identity to enc:ECL_04755)

Predicted SEED Role

"Type IV pilus biogenesis protein PilP" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (134 amino acids)

>EX28DRAFT_4150 Protein of unknown function (DUF2531) (Enterobacter asburiae PDN3)
MRNSARYLLVCSALLLTGMRDPFRPPDDPCAIGELAQWRYRGMVGGQQAIGILQDGQKRW
YRLKTHERFPAGWTITAINETELVVDVGDTCEPGKWTWQREGTNKNEFTDNAVAAGVQPS
AVGRRAKTGHAGGG