Protein Info for EX28DRAFT_4129 in Enterobacter asburiae PDN3

Annotation: Predicted amidophosphoribosyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00156: Pribosyltran
  • amino acids 170 to 225 (56 residues), 27.5 bits, E=9e-11

Best Hits

Swiss-Prot: 71% identical to GNTX_SALTY: DNA utilization protein YhgH (gntX) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 87% identity to enc:ECL_04777)

Predicted SEED Role

"Competence protein F homolog, phosphoribosyltransferase domain; protein YhgH required for utilization of DNA as sole source of carbon and energy"

Protein Sequence (227 amino acids)

>EX28DRAFT_4129 Predicted amidophosphoribosyltransferases (Enterobacter asburiae PDN3)
MLTVPGLCWLCQMPLALSGWGVCSVCTRALEWRIGICPQCGLPATNPSLPCGRCLKKSPP
WSALVAVDDYVPPLSRLIHALKFSGQSSLAQPLARLLLLAVLQARRQRALAKIDMVVNVP
LYRRRHWRRGYNQSDLICRPLARWLGCRYEASALTRVHATAIQHQLSARLRKRNLKNAFR
LELPVDGLHIAIVDDVVTTGSTVAELSRLLLRSGAASVQVWCLCRTL