Protein Info for EX28DRAFT_4118 in Enterobacter asburiae PDN3

Annotation: glycogen/starch synthase, ADP-glucose type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 TIGR02095: glycogen/starch synthase, ADP-glucose type" amino acids 1 to 476 (476 residues), 576.7 bits, see alignment E=1.8e-177 PF08323: Glyco_transf_5" amino acids 2 to 234 (233 residues), 248.2 bits, see alignment E=2.5e-77 PF13439: Glyco_transf_4" amino acids 127 to 221 (95 residues), 36.2 bits, see alignment E=1.6e-12 PF00534: Glycos_transf_1" amino acids 287 to 438 (152 residues), 49.1 bits, see alignment E=1.2e-16 PF13692: Glyco_trans_1_4" amino acids 294 to 437 (144 residues), 35.2 bits, see alignment E=3.7e-12

Best Hits

Swiss-Prot: 95% identical to GLGA_ENT38: Glycogen synthase (glgA) from Enterobacter sp. (strain 638)

KEGG orthology group: K00703, starch synthase [EC: 2.4.1.21] (inferred from 98% identity to enc:ECL_04791)

MetaCyc: 92% identical to glycogen synthase (Escherichia coli K-12 substr. MG1655)
Starch synthase. [EC: 2.4.1.21]

Predicted SEED Role

"Glycogen synthase, ADP-glucose transglucosylase (EC 2.4.1.21)" in subsystem Glycogen metabolism (EC 2.4.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>EX28DRAFT_4118 glycogen/starch synthase, ADP-glucose type (Enterobacter asburiae PDN3)
MQVLHVCSEMFPLLKTGGLADVLGALPAAQIAGGVDTRVLLPAFPDIRRGIPDAKVVTRR
ETFAGRITLLFGHYNGVGIYLIDAPHLYDRPGSPYHDTNLFAYTDNVLRFALLGWVGAEM
ATGLDPFWRPDVVHAHDWHAGLAPAYLAARGHPAKSVFTVHNLAYQGMYYAHHMSEIDLP
LSFYNMHGLEFNGQISFLKAGLYYADHITAVSPTYAREITQPEFGYGMEGLLQQRHREGR
LSGILNGVDEQIWSPETDLLLAARYGRDSVEDKAENKRQLQIAMGLKVNDKVPLFAVVSR
LTSQKGLDLVLEALPGLLEQGGQLALLGAGDPVLQEGFLAAAAEHPGQVGVQIGYHEAFS
HRIMGGADVILVPSRFEPCGLTQLYGLKYGTLPLVRRTGGLADTVSDSSLENLADGIASG
FVFEDSNAWSLLRAIRRAFVLWSRPSLWRYVQRQAMSMDFSWHVAAQSYRDLYQRLM