Protein Info for EX28DRAFT_4117 in Enterobacter asburiae PDN3

Annotation: glucose-1-phosphate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 333 to 348 (16 residues), see Phobius details TIGR02091: glucose-1-phosphate adenylyltransferase" amino acids 21 to 397 (377 residues), 516.3 bits, see alignment E=2.3e-159 PF12804: NTP_transf_3" amino acids 22 to 166 (145 residues), 27.9 bits, see alignment E=2.5e-10 PF00483: NTP_transferase" amino acids 22 to 291 (270 residues), 230.1 bits, see alignment E=3.1e-72

Best Hits

Swiss-Prot: 96% identical to GLGC_ENT38: Glucose-1-phosphate adenylyltransferase (glgC) from Enterobacter sp. (strain 638)

KEGG orthology group: K00975, glucose-1-phosphate adenylyltransferase [EC: 2.7.7.27] (inferred from 100% identity to enc:ECL_04792)

MetaCyc: 91% identical to glucose-1-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphate adenylyltransferase. [EC: 2.7.7.27]

Predicted SEED Role

"Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27)" in subsystem Glycogen metabolism (EC 2.7.7.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>EX28DRAFT_4117 glucose-1-phosphate adenylyltransferase (Enterobacter asburiae PDN3)
MVRLEKNDPLMLARQLPLKTVALILAGGRGTRLKDLTIKRAKPAVHFGGKFRIIDFALSN
CLNSGIRRIGVITQYQSHTLVQHIQRGWSFFSEEMNEFVDLLPAQQRVHGENWYRGTADA
VTQNLDIIRRYSAEYIVILAGDHIYKQDYSHMLIDHVEKGARCTVACLPVPVAEATAFGV
MHVDADDKIIDFVEKPANPPTMPGDDTKSLASMGIYVFDADYLYELLEEDDKDENSSHDF
GKDIIPKITKAGMAYAHPFPLSCVQSDPNAEPYWRDVGTLEAYWKANLDLASVTPELDMY
DQNWPIRTHMESLPPAKFVQDRSGSHGMTLNSLVSGGCIISGSVVVQSVLFPRVRINSFC
NIDSAVLLPDVWVGRSCRLRRCVIDRACVIPEGMVIGENAEEDARRFYRSEEGIVLVTRE
MLRKLQIKQER