Protein Info for EX28DRAFT_4116 in Enterobacter asburiae PDN3

Annotation: glycogen debranching enzyme GlgX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 TIGR02100: glycogen debranching enzyme GlgX" amino acids 7 to 632 (626 residues), 891.5 bits, see alignment E=1.6e-272 PF02922: CBM_48" amino acids 11 to 97 (87 residues), 64 bits, see alignment E=2e-21 PF00128: Alpha-amylase" amino acids 185 to 348 (164 residues), 39.5 bits, see alignment E=7.8e-14 PF18390: GlgX_C" amino acids 571 to 655 (85 residues), 151.7 bits, see alignment E=6.2e-49

Best Hits

Swiss-Prot: 86% identical to GLGX_ENT38: Glycogen debranching enzyme (glgX) from Enterobacter sp. (strain 638)

KEGG orthology group: K02438, glycogen operon protein GlgX [EC: 3.2.1.-] (inferred from 96% identity to enc:ECL_04793)

MetaCyc: 79% identical to limit dextrin alpha-1,6-glucohydrolase (Escherichia coli K-12 substr. MG1655)
RXN0-5146 [EC: 3.2.1.196]

Predicted SEED Role

"Glycogen debranching enzyme (EC 3.2.1.-)" in subsystem Glycogen metabolism or Trehalose Biosynthesis (EC 3.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.- or 3.2.1.196

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (657 amino acids)

>EX28DRAFT_4116 glycogen debranching enzyme GlgX (Enterobacter asburiae PDN3)
MTQLTAGKPEPLGARFDGKGVNFTLFSAHAERVELCVFDGEGNEHRYDLPERTGDTWHGY
LAGGRPGMHYGFRVHGPWDPAQGHWFNPEKLLIDPCAHRVDGEFKDDPLFHVGYGEPDHR
DSAPVAPKSVVVNDLYDWEDDVPPQTPWGNTVIYEAHVKGLTYLHPSIPKEMRGTYKALG
HPTMIAYLNHLGITALELLPVAHFASEPRLQRLGLSNYWGYNPLAMFALEPRYAAHPEKA
RDEFRDAVKALHTAGIEVILDVVLNHSAESDLDGPTLSMRGIDNRSYYWIRQDGDYENWT
GCGNTLNLSHPAVTHFAYECLKYWVETFHVDGFRFDLAPVMGRTPAFSQQAPLFEAIKNC
PVLSQVKLIAEPWDIGEGGYQVGNFPPLFAEWNDHYRDAARRFWLERNLSLGEFAGRFAA
SSDLFKRDGKRPSATVNLLTAHDGFTLRDCVCFNQKHNEANGEENRDGTNNNHSFNHGIE
GLGGSLDVIERRRASVHALLTTLLLSQGTPMLLAGDEHGHSQHGNNNAYCQDNTLTWLDW
GEANSGLIHFTAALIHLRQQIPALTADRWWEEGDGNVRWLNQDAQPLSAQEWQHGVPRLQ
ILLSDKWLVTLNATDDVAEIVLPEGEWRAVPPFAGADNPVVMAVWHGPAHGVCVFQR