Protein Info for EX28DRAFT_4109 in Enterobacter asburiae PDN3

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 137 to 139 (3 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 174 to 175 (2 residues), see Phobius details amino acids 177 to 177 (1 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 342 to 365 (24 residues), see Phobius details amino acids 370 to 388 (19 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 301 (278 residues), 70.8 bits, see alignment E=5.1e-24 amino acids 276 to 392 (117 residues), 36.8 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 86% identical to YHHS_ECOL6: Uncharacterized MFS-type transporter YhhS (yhhS) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 95% identity to enc:ECL_04838)

Predicted SEED Role

"Transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>EX28DRAFT_4109 Arabinose efflux permease (Enterobacter asburiae PDN3)
MPEPAAEPALSGLRLNLRIVSVVIFNFASYLTIGLPLAVLPGYVHDVMGFSAFWAGLVIS
LQYFATLLSRPHAGRYADTFGPKSIVVVGLCGCFLSGLSYLLAAATSHWPLVSLALLCLG
RVILGIGQSLAGTGSTLWGVGVVGAPHIGRVISWNGIVTYGAMALGAPLGVACYALGGLH
GLAITIMAVALLAILFALPRPKVKASKGKPLPFRAVLGRVWPYGMALALATTGFGVIATF
ITLFYDAKGWDGAAFALTLFSCAFVGARLLFPNGINRLGGLNVAMICFAIEIVGLLLTGI
AMVPWVAKVGVFLAGAGFSLVFPALGVVAVKAVPQQNQGAALATYTVFMDMSLGITGPLA
GLVMAWAGVPVIYLAAAGLVVIALLLTWRLKKWPPVQAPEATSSS