Protein Info for EX28DRAFT_4082 in Enterobacter asburiae PDN3

Annotation: Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01041: DegT_DnrJ_EryC1
  • amino acids 11 to 373 (363 residues), 444.9 bits, E=5e-137
• PF01053: Cys_Met_Meta_PP
  • amino acids 32 to 165 (134 residues), 31.2 bits, E=1.7e-11
• PF01212: Beta_elim_lyase
  • amino acids 33 to 217 (185 residues), 32.4 bits, E=1.3e-11
• PF00155: Aminotran_1_2
  • amino acids 35 to 163 (129 residues), 33.8 bits, E=4.6e-12

Best Hits

Swiss-Prot: 85% identical to ARNB_KLEP3: UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (arnB) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K07806, UDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferase [EC: 2.6.1.87] (inferred from 93% identity to enc:ECL_04863)

MetaCyc: 81% identical to UDP-4-amino-4-deoxy-L-arabinose aminotransferase (Escherichia coli K-12 substr. MG1655)
RXN0-1863 [EC: 2.6.1.87, 2.6.1.92]

Predicted SEED Role

"UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (EC 2.6.1.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.6.1.-)

MetaCyc Pathways

• polymyxin resistance (5/6 steps found)
• UDP-2-acetamido-4-amino-2,4,6-trideoxy-α-D-galactose biosynthesis (1/2 steps found)
• UDP-yelosamine biosynthesis (1/3 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Arginine and proline metabolism
• Caprolactam degradation
• Lysine biosynthesis
• Lysine degradation
• Methionine metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.- or 2.6.1.87 or 2.6.1.92

Protein Sequence (379 amino acids)

>EX28DRAFT_4082 Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis (Enterobacter asburiae PDN3)
MSDFLPFSRPSMGAEEIAALQDVLMSGWITTGPKNQELEEAFCQLTGNQHAIAVCSATAG
MHVTLMALDIGPGDEVITPSQTWVSTLNMIVLLGATPVMIDVDKDTLMVTPEAVEAAITP
RTKAIIPVHYAGAPCEIDAIHAIGERHGIPVIEDAAHAAGTYYKNRHVGWKGTAIFSFHA
IKNMTCAEGGLVVTDNAQLAQRIRSLKFHGLGVDAYDRQTHGRAPQAEVIAPGYKYNLAD
INAALALVQLGKLKEANRRRQEIAERYLRELADTPFQPLTIPSWPHVHAWHLFIIRVDEA
RCGISRDNLMAALKEKGIGTGLHFRAAHTQKYYRERFPDVSLPNSEWNSARICSLPLFPD
MTHDDTTRVITALHQLAGH