Protein Info for EX28DRAFT_4076 in Enterobacter asburiae PDN3

Annotation: integral membrane protein, TerC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 220 to 246 (27 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 311 to 335 (25 residues), see Phobius details TIGR03718: integral membrane protein, TerC family" amino acids 10 to 336 (327 residues), 341.8 bits, see alignment E=2e-106 PF03741: TerC" amino acids 73 to 300 (228 residues), 140.9 bits, see alignment E=1.9e-45

Best Hits

Swiss-Prot: 81% identical to TERC_SERMA: Tellurium resistance protein TerC (terC) from Serratia marcescens

KEGG orthology group: K05794, tellurite resistance protein TerC (inferred from 98% identity to enc:ECL_04868)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>EX28DRAFT_4076 integral membrane protein, TerC family (Enterobacter asburiae PDN3)
MSAAHLGFPTETVVVFVVMAVGAMFIDLFMHRHDKPVSLKSAAMWSIFWVMMAMAFAGFL
YVHHGAEMASLFLTGYALEEVLSVDNLFVMMAIFAWFGVPDKYRHRVLYWGVLGAIVFRG
IFVAIGTSLLSLGPYVEVIFALVVGWTAVMMLRRNEESDEVEDYSGHLAYRLVKRFYPVW
PKISSNAFILTQKEVDAELEKPENQDVMVGRVKKAKRYATPLLLCVAVVELSDVMFAFDS
VPAIIAVSREPLIIYSAMMFAILGLRTLYFVLEALKQYLVHLEKAVVLLLFFVAFKLGLN
ATDHFWHHGYSIGATASLFVVLGVLALGIIASVMFPGKREA