Protein Info for EX28DRAFT_4072 in Enterobacter asburiae PDN3
Annotation: Demethylmenaquinone methyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 37% identical to GALC_PSEPK: 4-carboxy-4-hydroxy-2-oxoadipic acid aldolase (galC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
KEGG orthology group: None (inferred from 90% identity to enc:ECL_04871)MetaCyc: 37% identical to subunit of 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Pseudomonas putida)
4-hydroxy-4-methyl-2-oxoglutarate aldolase. [EC: 4.1.3.17]; 4.1.3.17 [EC: 4.1.3.17]
Predicted SEED Role
"Demethylmenaquinone methyltransferase"
MetaCyc Pathways
- gallate degradation I (2/4 steps found)
- methylgallate degradation (3/6 steps found)
- gallate degradation II (2/5 steps found)
- protocatechuate degradation I (meta-cleavage pathway) (4/8 steps found)
- superpathway of vanillin and vanillate degradation (4/10 steps found)
- syringate degradation (4/12 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.3.17
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (230 amino acids)
>EX28DRAFT_4072 Demethylmenaquinone methyltransferase (Enterobacter asburiae PDN3) MSVTEKKPINRHFERVSAEDVRRAAEYQAAILADVAGRRGTLHGRIKPLAPHMSVAGPAI TVEVRPGDNLAIHAAMAVAQPGDVLIVDGKGDLSCALLGEIMATQAQASGIAGIIIDGAV RDADTLSKGHYPVFSAGLNPCGPTKLISGRVNHPISVAGATVQAGDLVVADIDGVVVIPR DEVQEVIALAKEKLEMETRRLAAIREGDLRPRWLDDALRKAGMLSDGETL