Protein Info for EX28DRAFT_4054 in Enterobacter asburiae PDN3

Annotation: metabolite-proton symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 28 to 53 (26 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 121 to 147 (27 residues), see Phobius details amino acids 165 to 188 (24 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 346 to 370 (25 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details amino acids 411 to 431 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 23 to 226 (204 residues), 81.7 bits, see alignment E=5.4e-27 amino acids 266 to 439 (174 residues), 38.4 bits, see alignment E=7.4e-14 PF07690: MFS_1" amino acids 29 to 384 (356 residues), 95.4 bits, see alignment E=3.5e-31 amino acids 282 to 434 (153 residues), 47 bits, see alignment E=1.9e-16 TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 30 to 426 (397 residues), 503.4 bits, see alignment E=2.5e-155

Best Hits

Swiss-Prot: 90% identical to YHJE_ECOLI: Inner membrane metabolite transport protein YhjE (yhjE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to enc:ECL_04926)

Predicted SEED Role

"Inner membrane metabolite transport protein YhjE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>EX28DRAFT_4054 metabolite-proton symporter (Enterobacter asburiae PDN3)
MQATATTLDSGTENVPVNSRNKVVVASLIGTAIEFFDFYIYATAAVIVFPHIFFPQGDPT
AATLQSLATFAIAFVARPIGSALFGHFGDRIGRKVTLVASLLTMGISTVAIGLLPTYETI
GILAPVLLALARFGQGLGLGGEWGGAALLATENAPARKRALYGSFPQLGAPIGFFFANGT
FLLLSWLLTDEQFMSWGWRLPFIFSAVLVLIGLYVRVSLHETPVFAKVAAANKQVKVPLG
TLLTKHVRVTVLGTFIMLATYTLFYIMTVYSMTFSTAAAPVGLGLPRNEVLWMLMMAVIG
FGVMVPIAGLLADKFGRRSSMIVITTLIILFALFVFPPLLGSGSPALVMAYLLIGLSLMG
LTFGPMGALLPELFPTEVRYTGASFSYNVASILGASVAPYIATWLQANYGLFYVGVYLAA
MAALTLIALLLTHETKHQAL