Protein Info for EX28DRAFT_4044 in Enterobacter asburiae PDN3

Annotation: cellulose synthase catalytic subunit (UDP-forming)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 871 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 173 to 190 (18 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 228 to 252 (25 residues), see Phobius details amino acids 523 to 548 (26 residues), see Phobius details amino acids 553 to 571 (19 residues), see Phobius details amino acids 639 to 659 (21 residues), see Phobius details amino acids 665 to 690 (26 residues), see Phobius details amino acids 836 to 852 (17 residues), see Phobius details TIGR03030: cellulose synthase catalytic subunit (UDP-forming)" amino acids 147 to 830 (684 residues), 1000.4 bits, see alignment E=2e-305 PF13641: Glyco_tranf_2_3" amino acids 273 to 500 (228 residues), 63.3 bits, see alignment E=8.4e-21 PF00535: Glycos_transf_2" amino acids 278 to 447 (170 residues), 85.7 bits, see alignment E=1.1e-27 PF13506: Glyco_transf_21" amino acids 340 to 568 (229 residues), 31.8 bits, see alignment E=2.1e-11 PF13632: Glyco_trans_2_3" amino acids 356 to 565 (210 residues), 68.1 bits, see alignment E=2.9e-22 PF03552: Cellulose_synt" amino acids 446 to 671 (226 residues), 47.4 bits, see alignment E=3.6e-16 PF07238: PilZ" amino acids 694 to 790 (97 residues), 54.8 bits, see alignment E=3.1e-18

Best Hits

Swiss-Prot: 87% identical to BCSA_SALTI: Cellulose synthase catalytic subunit [UDP-forming] (bcsA) from Salmonella typhi

KEGG orthology group: K00694, cellulose synthase (UDP-forming) [EC: 2.4.1.12] (inferred from 97% identity to enc:ECL_04938)

MetaCyc: 87% identical to cellulose synthase catalytic subunit (Escherichia coli K-12 substr. MG1655)
Cellulose synthase (UDP-forming). [EC: 2.4.1.12]

Predicted SEED Role

"Cellulose synthase catalytic subunit [UDP-forming] (EC 2.4.1.12)" (EC 2.4.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.12

Use Curated BLAST to search for 2.4.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (871 amino acids)

>EX28DRAFT_4044 cellulose synthase catalytic subunit (UDP-forming) (Enterobacter asburiae PDN3)
MSRLASWLLIPPVSSRLSEHYRHFRRHGASAFSAALGCFWMILAWMFIPLEHPRWQRIRA
RHSELYPHINPNRPRPLDPARYLIQAIWLVVTSSRSEKITPHWRSFSRVQQLRERYHQWL
DRLPNSVSDKTSHLDNHKELGHLHPGLRRFILGVIVVFSLILALVCITQPFNPLAQFTFL
ILLWGVALLVRRIPGRFSALMLIVLSLTVSCRYIWWRYTSTLNWDDPVSLVCGLVLLFAE
TYAWIVLVLGYFQVIWPLNRQPVPLPKDTAQWPSVDLFVPTYNEDLSVVKNTIYAALGID
WPKDKLKVWILDDGNRPAFRQFAEEVGVEYIARPTHEHAKAGNINNALKYATGEFVSIFD
CDHVPTRSFLQMTMGWFLKEKELAMMQTPHHFFSPDPFERNLGRFRKTPNEGTLFYGLVQ
DGNDMWDATFFCGSCAVIRRKPLDEIGGIAVETVTEDAHTSLRLHRRGYTSAYMRIPQAA
GLATESLSAHIGQRIRWARGMVQIFRLDNPLIGKGLKLAQRLCYVNAMFHFLSGIPRLIF
LTAPLAFLLLHAYIIYAPALMIALFVLPHMIHASLTNSKIQGKYRHSFWSEIYETVLAWY
IAPPTMVALINPHKGKFNVTAKGGLVEEEYVDWVISRPYIFLVLLNIVGVIAGIWRYFYG
PENEILTVFVSMAWVFYNLIILGGAVAVSVESKQVRRAHRVEICMPAAIAREDGHLFSCT
VHDFSDGGLGIKINGQAKVLEGQKVNLLLKRGQQEYVFPTQVVRVAGNEVGLQLMPLTKK
QHIDFVQCTFARADTWALWQDSFPEDKPLESLLDILKLGFRGYRHLAEFAPSSVKLIFRS
LTSLVSWVVSFIPRRPERDEAKQADPVMAQQ