Protein Info for EX28DRAFT_4039 in Enterobacter asburiae PDN3

Annotation: cellulose synthase operon protein YhjU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 transmembrane" amino acids 32 to 56 (25 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details TIGR03368: cellulose synthase operon protein YhjU" amino acids 23 to 557 (535 residues), 802.4 bits, see alignment E=7.5e-246 PF11658: CBP_BcsG" amino acids 24 to 554 (531 residues), 789.8 bits, see alignment E=5.5e-242

Best Hits

Swiss-Prot: 84% identical to BCSG_SALTY: Cellulose biosynthesis protein BcsG (bcsG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 98% identity to enc:ECL_04944)

MetaCyc: 84% identical to cellulose phosphoethanolamine transferase (Escherichia coli K-12 substr. MG1655)
2.7.8.-

Predicted SEED Role

"FIG002337: predicted inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (559 amino acids)

>EX28DRAFT_4039 cellulose synthase operon protein YhjU (Enterobacter asburiae PDN3)
MTNSTYTASSPSPLWQYWRGLSGWNFYFLVKFGLLWAGYLNFHPLLNLVFMAFLLMPLPN
IRLHRLRHWVAIPVGFALFWHDTWLPGPDSIMSQGSQVAGFSASYVLDLTERFINWQMIG
AVFVLLVAWLFLSQWIRVTVFVVAIMIWLNVLTLAGPNFSLWPAGQPTTTVTTTGGSAAA
TVTTAGDTPVVGDIPTQTAPPTSTNLNAWLSSFYTAEDKRQTKFPDALPADAQPFELLVI
NICSLSWADVDAAGLMSHPLWSHFDIQFKDFNSATSYSGPAAIRLLRASCGQTSHKNLYQ
PAGNQCYLFDNLAKLGFTQHLMLGHNGQFGNFLKEVREQGGMQAPLMDQTGLPVSLLGFD
GSPVYDDTAVLQRWLQTIEKDSNPRSATFFNTLPLHDGNHFPGVSKTADYKVRAQKFFDE
LDAFFTELEKSGRKVMVVVVPEHGGALKGDRMQVSGLRDIPSPSITNVPAGIKFFGMKAP
HQGAPIEITQPTSYLAISELVARAVDGKLFVEDSVNWDQLTSNLPQTAEVSENANAVVIQ
YQNKPYVRLNGGDWVPYPQ