Protein Info for EX28DRAFT_4011 in Enterobacter asburiae PDN3

Annotation: ATP synthase, F1 delta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 TIGR01145: ATP synthase F1, delta subunit" amino acids 7 to 175 (169 residues), 215 bits, see alignment E=4.2e-68 PF00213: OSCP" amino acids 7 to 174 (168 residues), 169.4 bits, see alignment E=4.1e-54

Best Hits

Swiss-Prot: 96% identical to ATPD_ENT38: ATP synthase subunit delta (atpH) from Enterobacter sp. (strain 638)

KEGG orthology group: K02113, F-type H+-transporting ATPase subunit delta [EC: 3.6.3.14] (inferred from 99% identity to enc:ECL_05146)

MetaCyc: 90% identical to ATP synthase F1 complex subunit delta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP synthase delta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>EX28DRAFT_4011 ATP synthase, F1 delta subunit (Enterobacter asburiae PDN3)
MSEFVTVARPYAKAAFDFAVEHQNVDRWQDMLAFAAEVTKNEQMAELLSGALAPETLAAS
FIAVCGEQLDANGQNLIKVMAENGRLRVLPDVLEQFEHLRALSEATAEVEVTSATELSNE
QLAKITAAMEKRLSRKVKLNCKIDKSVMAGVIIRSGDMVIDGSVRGRLERLADVLQS