Protein Info for EX28DRAFT_3994 in Enterobacter asburiae PDN3

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 40 to 58 (19 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 128 to 152 (25 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 326 to 348 (23 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 341 (331 residues), 151.5 bits, see alignment E=3e-48 PF00083: Sugar_tr" amino acids 36 to 175 (140 residues), 43.9 bits, see alignment E=1.6e-15

Best Hits

Swiss-Prot: 72% identical to MDTL_ECO27: Multidrug resistance protein MdtL (mdtL) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: K08163, MFS transporter, DHA1 family, multidrug resistance protein (inferred from 92% identity to ent:Ent638_4147)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>EX28DRAFT_3994 Arabinose efflux permease (Enterobacter asburiae PDN3)
MARFLFCSFALVLLYPSGIDMYLVGLPHIARDLGASEAQLHIAFSAYLAGMASSMVFAGK
IADKAGRQPVAITGAIIFALASLLCSQAQSSTVFLAGRFIQGIGAGGCYVVAFAILRDTL
SAQRRAKVLSMLNGITCIIPVLAPVVGYLIMLKFPWQSLFWTMAAMGALVFILSISVLKE
THPGSQNTGHTATIHPAEKLLNRFFLSRLAVTTLSVAVILTYVNVSPVLLMETMGFDRGE
YSTVMALTAMVSMAVSFSTPFALNVFSQRALMLTSQVLFLTASAILATASSHAVMLAGIT
LICAGFSVGFGVAMSQALGPFSLRAGVASSVLGIAQVCGSSLWIWLAAVIGLNALNMLIG
VLIGCSILCITLLMVIQPAAHYEEAHQQSRS