Protein Info for EX28DRAFT_3983 in Enterobacter asburiae PDN3

Annotation: HAD-superfamily hydrolase, subfamily IIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF00702: Hydrolase" amino acids 3 to 232 (230 residues), 39.3 bits, see alignment E=1.5e-13 PF05116: S6PP" amino acids 4 to 82 (79 residues), 25.2 bits, see alignment E=1.7e-09 amino acids 178 to 244 (67 residues), 32.3 bits, see alignment E=1.2e-11 TIGR00099: Cof-like hydrolase" amino acids 5 to 264 (260 residues), 251.2 bits, see alignment E=1.2e-78 TIGR01484: HAD hydrolase, family IIB" amino acids 5 to 237 (233 residues), 110.3 bits, see alignment E=1.5e-35 PF08282: Hydrolase_3" amino acids 6 to 264 (259 residues), 225.1 bits, see alignment E=1.9e-70

Best Hits

Swiss-Prot: 94% identical to YIDA_SHIFL: Sugar phosphatase YidA (yidA) from Shigella flexneri

KEGG orthology group: K07024, (no description) (inferred from 98% identity to enc:ECL_00007)

MetaCyc: 94% identical to sugar phosphatase YidA (Escherichia coli K-12 substr. MG1655)
Sugar-phosphatase. [EC: 3.1.3.23]

Predicted SEED Role

"Promiscuous sugar phosphatase YidA, haloacid dehalogenase-like phosphatase family"

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.23

Use Curated BLAST to search for 3.1.3.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>EX28DRAFT_3983 HAD-superfamily hydrolase, subfamily IIB (Enterobacter asburiae PDN3)
MAIKLIAIDMDGTLLLPDHTISPAVKNAIAAARAKGVNVVLTTGRPYAGVHSYLKELHMN
QPGDYCITYNGALVQKAADGSTVAQTALSYDDYLFLEKLSREVGSHFHALDRNTLYTANR
DISYYTVHESYVATIPLVFCEAEKMDPATQFLKVMMIDEPEILDKAIARIPAEVKEKYTV
LKSAPYFLEILDKRVNKGTGVKSLADALGIKPEEIMALGDQENDIAMIEFAGMGVAMDNA
IPSVKEVANFVTKSNLEDGVAYAIEKFVLQ