Protein Info for EX28DRAFT_3969 in Enterobacter asburiae PDN3

Annotation: Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details PF02056: Glyco_hydro_4" amino acids 6 to 184 (179 residues), 221.3 bits, see alignment E=7.4e-70 PF11975: Glyco_hydro_4C" amino acids 195 to 415 (221 residues), 189.8 bits, see alignment E=6.6e-60

Best Hits

Swiss-Prot: 94% identical to AGLB_KLEPN: 6-phospho-alpha-glucosidase (aglB) from Klebsiella pneumoniae

KEGG orthology group: K01232, maltose-6'-phosphate glucosidase [EC: 3.2.1.122] (inferred from 98% identity to enc:ECL_00020)

MetaCyc: 73% identical to maltose-6'-phosphate glucosidase (Bacillus subtilis subtilis 168)
Maltose-6'-phosphate glucosidase. [EC: 3.2.1.122]

Predicted SEED Role

"Maltose-6'-phosphate glucosidase (EC 3.2.1.122)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Uptake and Utilization (EC 3.2.1.122)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.122

Use Curated BLAST to search for 3.2.1.122

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>EX28DRAFT_3969 Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases (Enterobacter asburiae PDN3)
MKKFSVVIAGGGSTFTPGIVLMLLANRDRFPLRALKFYDNDGARQETIAEACKIILREQA
PDIEFSYTTDPKAAFTDVDFVMAHIRVGKYPMREKDEKIPLRHGVLGQETCGPGGISYGM
RSIGGVLELVDYMEQYSPNAWMLNYSNPAAIVAEATRRLRPNAKILNICDMPIGIEGRMA
QIVGLKDRKEMRVRYYGLNHFGWWTSIEDLNGNDLMPKLREYVAKKGYVPPSEDAHTEAS
WNDTFAKAKDVQALDPDTMPNTYLKYYLFPDYVVAHSNPERTRANEVMDHREKHVFSSCR
AIIEAGNSAAGELEIDEHASYIVDLATAIAFNTQERMLLIVPNNGAIHNFDADAMVEIPC
LVGHNGPEPLTVGDIPHFQKGLMSQQVAVEKLVVDAWEQRSYQKLWQAITLSKTVPSASV
AKAILDDLIEANKEYWPELH