Protein Info for EX28DRAFT_3967 in Enterobacter asburiae PDN3

Annotation: Domain of unknown function (DUF202)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details PF02656: DUF202" amino acids 12 to 69 (58 residues), 44.3 bits, see alignment E=1e-15

Best Hits

Swiss-Prot: 75% identical to YIDG_ECOLI: Inner membrane protein YidG (yidG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to enc:ECL_00022)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (115 amino acids)

>EX28DRAFT_3967 Domain of unknown function (DUF202) (Enterobacter asburiae PDN3)
MADSRKARREADPGLQPERTSLAWLRTLLGYGALIALAIKHNWHRTGVPFWISIVVLAMV
AIILWRYTRSRNLMDVAQNDFVQPKAVRDKFLIALAVLSLSLLFAVTHIQQILSL