Protein Info for EX28DRAFT_3964 in Enterobacter asburiae PDN3

Annotation: D-serine deaminase transcriptional activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 TIGR02036: D-serine deaminase transcriptional activator" amino acids 8 to 305 (298 residues), 539.7 bits, see alignment E=8e-167 PF00126: HTH_1" amino acids 18 to 76 (59 residues), 73.3 bits, see alignment E=1.3e-24 PF03466: LysR_substrate" amino acids 99 to 306 (208 residues), 105.1 bits, see alignment E=3.4e-34

Best Hits

Swiss-Prot: 83% identical to DSDC_ECOLI: HTH-type transcriptional regulator DsdC (dsdC) from Escherichia coli (strain K12)

KEGG orthology group: K13636, LysR family transcriptional regulator, D-serine deaminase activator (inferred from 94% identity to enc:ECL_00025)

Predicted SEED Role

"D-serine dehydratase transcriptional activator" in subsystem Glycine and Serine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>EX28DRAFT_3964 D-serine deaminase transcriptional activator (Enterobacter asburiae PDN3)
MTDANEARNRLLNGWQLSKMYTFEVAARHESFALAAEELSLSPSAVSHRINLLEEELGIQ
LFVRSHRKVELTKEGKRVYWTLKSSLDTLNQEILDIKNQALSGTLTVYSRPSIAQCWLVP
MLGDFTRRYPSISLTILTGNDYVNMQRTGVDLALYFDDTPPNHLSHHFLMDEEILPVCSP
QYAREHELLKNPDNLSHCTLLHDRQAWSNDSGTDEWLSWAQHFSVNMPPSSGISFDRSDL
AIIAAINHVGVAMGRKRLVQKRLERGELIAPFGEKTLKCHQHYYISTLSGRQWPKIDAFI
GWLRELAG