Protein Info for EX28DRAFT_3924 in Enterobacter asburiae PDN3

Annotation: hydroxyisourate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02962: hydroxyisourate hydrolase
  • amino acids 26 to 136 (111 residues), 143.6 bits, E=1.5e-46
• PF00576: Transthyretin
  • amino acids 27 to 135 (109 residues), 126.1 bits, E=4.6e-41

Best Hits

Swiss-Prot: 56% identical to HIUH_SALDU: 5-hydroxyisourate hydrolase (hiuH) from Salmonella dublin

KEGG orthology group: K07127, 5-hydroxyisourate hydrolase [EC: 3.5.2.17] (inferred from 94% identity to enc:ECL_00086)

MetaCyc: 56% identical to hydroxyisourate hydrolase / transthyretin-related protein (Escherichia coli K-12 substr. MG1655)
Hydroxyisourate hydrolase. [EC: 3.5.2.17]

Predicted SEED Role

"Transthyretin family protein"

MetaCyc Pathways

• ureide biosynthesis (6/7 steps found)
• urate conversion to allantoin I (3/3 steps found)
• urate conversion to allantoin II (3/3 steps found)
• urate conversion to allantoin III (2/3 steps found)
• superpathway of purines degradation in plants (11/18 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.17

Use Curated BLAST to search for 3.5.2.17

Protein Sequence (136 amino acids)

>EX28DRAFT_3924 hydroxyisourate hydrolase (Enterobacter asburiae PDN3)
MKKTAPLLILASMAFAPAAFSAPAGTLSVHILDQQTGMPPSDVTVTLEKQQQDKWTPIAS
GKTDHDGRIKSLYPQDQDMQPGVYKVTFKTADYFHGKKLDSFFPEIPVLFTVTRTNEKLH
IPLLLSQYGYSTYKGS