Protein Info for EX28DRAFT_3918 in Enterobacter asburiae PDN3

Annotation: P pilus assembly protein, chaperone PapD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00345: PapD_N" amino acids 22 to 139 (118 residues), 117.8 bits, see alignment E=3e-38 PF02753: PapD_C" amino acids 162 to 216 (55 residues), 45 bits, see alignment E=1.1e-15

Best Hits

Swiss-Prot: 42% identical to FIMC_ECOLI: Chaperone protein FimC (fimC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 84% identity to enc:ECL_00092)

Predicted SEED Role

"chaperone FimC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>EX28DRAFT_3918 P pilus assembly protein, chaperone PapD (Enterobacter asburiae PDN3)
MRVNTWICLAGALCSSAVYAGGVGLGATRMVYSSATSQAMMQVRNTHPDATFLIQSWMEN
EKGERTNDFAITPPLYVMKPASESAVKIMFNGKALPADRETLYWMTVKAIPQQAKSGAGN
TLQFASANRIKVFYRPEGLSESPGEAWKKLAGAYRAGKVTLSNPTPYYLTTINVKIDGMP
VQPVMVPPKGSVTLAETFSHAGSMSYQTINDYGAWTPATRASLSQ