Protein Info for EX28DRAFT_3911 in Enterobacter asburiae PDN3

Annotation: Sortase and related acyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 PF00583: Acetyltransf_1" amino acids 51 to 125 (75 residues), 35.8 bits, see alignment E=1.3e-12 PF13673: Acetyltransf_10" amino acids 51 to 137 (87 residues), 50.8 bits, see alignment E=2.6e-17 PF13508: Acetyltransf_7" amino acids 54 to 127 (74 residues), 46.9 bits, see alignment E=4.5e-16

Best Hits

KEGG orthology group: K03827, putative acetyltransferase [EC: 2.3.1.-] (inferred from 93% identity to enc:ECL_00099)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>EX28DRAFT_3911 Sortase and related acyltransferases (Enterobacter asburiae PDN3)
MIRPMKIETALHTHFERLVAIWESSVRATHHFLQESDIAALRPLLLNAYLPNLKVVIARD
DAGVIHGFLGVDENRIEMLFVDDASRGKGVGKLLLQHAIAAFGVNEVDVNEQNPQGVAFY
RHMGFEQVGRSELDGQGNPFPLLHMRLGE