Protein Info for EX28DRAFT_3903 in Enterobacter asburiae PDN3

Annotation: uracil-xanthine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 36 to 62 (27 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 350 to 372 (23 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details amino acids 408 to 428 (21 residues), see Phobius details amino acids 439 to 458 (20 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 29 to 457 (429 residues), 463.2 bits, see alignment E=4.2e-143 PF00860: Xan_ur_permease" amino acids 34 to 426 (393 residues), 369.3 bits, see alignment E=9.8e-115

Best Hits

Swiss-Prot: 94% identical to XANP_ECO57: Xanthine permease XanP (xanP) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 99% identity to enc:ECL_00106)

MetaCyc: 94% identical to xanthine:H+ symporter XanP (Escherichia coli K-12 substr. MG1655)
RXN-5076

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>EX28DRAFT_3903 uracil-xanthine permease (Enterobacter asburiae PDN3)
MSVNTIESPDAQPIAQKQNSELIYRLEDRPPLPQTLFAACQHLLAMFVAVITPALLICQA
LGLPAQDTQHIISMSLFASGVASIIQIKAWGPVGSGLLSIQGTSFNFVAPLIMGGTALKT
GGADVPTMMAALFGTLMLASCTEMVISRVLHLARRVITPLVSGVVVMIIGLSLIQVGLTS
IGGGYAAMSDHTFGAPKNLLLAGVVLAIIILLNRQRNPYLRVASLVIAMAAGYLLAWALG
MLPENTAPTNSALIVVPTPLYYGLGIDWGLLLPLMLVFMITSLETIGDITATSDVSEQPV
SGPLYMKRLKGGVLANGLNSFVSAVFNTFPNSCFGQNNGVIQLTGVASRYVGFVVALMLI
VLGLFPAVSGFVQHIPEPVLGGATLVMFGTIAASGVRIVSREPLNRRAIMIIALSLAVGL
GVSQQPLILQFAPDWVKNLLSSGIAAGGITAIVLNLVFPPEKN