Protein Info for EX28DRAFT_3878 in Enterobacter asburiae PDN3

Annotation: lipopolysaccharide heptosyltransferase III, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR02201: putative lipopolysaccharide heptosyltransferase III" amino acids 13 to 356 (344 residues), 507.8 bits, see alignment E=6.8e-157 PF01075: Glyco_transf_9" amino acids 85 to 327 (243 residues), 178.7 bits, see alignment E=6.6e-57

Best Hits

KEGG orthology group: K02849, heptosyltransferase III [EC: 2.4.-.-] (inferred from 93% identity to enc:ECL_00133)

Predicted SEED Role

"Lipopolysaccharide heptosyltransferase III (EC 2.4.1.-)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.-.-, 2.4.1.-

Use Curated BLAST to search for 2.4.-.- or 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>EX28DRAFT_3878 lipopolysaccharide heptosyltransferase III, putative (Enterobacter asburiae PDN3)
MMMNNLPDTPDLRILLIKLRHHGDMLLTTPVIDSLRQKWPQAQIDVLLYEETRDMLAAHP
AIGTIFGIDRKWKQLGTLKHLQKEWRLLCALRNQHYHLVINLADQWRSAIVTRFTGAPVR
LGFAFNKRNSAFWRFCHTDLVSVDGHKSLHTVEQNLSILAPLPVAPQPAVTMAYAAEDWD
HARQRLTQTGVGDSYIVIQPTSRWFFKCWSEDKMAQTITALQQDGHTVVLTAGPDKKELA
MIDRILAASPKTGVVSLAGQLTLRQLASLIDHARLFIGVDSVPMHMAAALQTPCVALFGP
SKLTFWSPWQVKGEVIWAGDYGPLPDPDAIDTKTKERYLDAIPVDAVVSAARRYLS