Protein Info for EX28DRAFT_3871 in Enterobacter asburiae PDN3

Annotation: ADP-L-glycero-D-manno-heptose-6-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 TIGR02197: ADP-glyceromanno-heptose 6-epimerase" amino acids 2 to 308 (307 residues), 455 bits, see alignment E=6.7e-141 PF04321: RmlD_sub_bind" amino acids 2 to 174 (173 residues), 37.7 bits, see alignment E=4e-13 PF01370: Epimerase" amino acids 2 to 236 (235 residues), 146.4 bits, see alignment E=3.1e-46 PF16363: GDP_Man_Dehyd" amino acids 3 to 255 (253 residues), 73.7 bits, see alignment E=5.9e-24 PF01073: 3Beta_HSD" amino acids 3 to 220 (218 residues), 46.5 bits, see alignment E=7.6e-16

Best Hits

Swiss-Prot: 99% identical to HLDD_KLEP7: ADP-L-glycero-D-manno-heptose-6-epimerase (hldD) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K03274, ADP-L-glycero-D-manno-heptose 6-epimerase [EC: 5.1.3.20] (inferred from 100% identity to enc:ECL_00140)

MetaCyc: 97% identical to ADP-L-glycero-D-mannoheptose 6-epimerase (Escherichia coli K-12 substr. MG1655)
ADP-glyceromanno-heptose 6-epimerase. [EC: 5.1.3.20]

Predicted SEED Role

"ADP-L-glycero-D-manno-heptose-6-epimerase (EC 5.1.3.20)" in subsystem LOS core oligosaccharide biosynthesis (EC 5.1.3.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>EX28DRAFT_3871 ADP-L-glycero-D-manno-heptose-6-epimerase (Enterobacter asburiae PDN3)
MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVDLNIADYMDKEDFLIQI
MAGEEFGEIEAIFHEGACSSTTEWDGKYMMDNNYQYSKEILHYCLEREIPFLYASSAATY
GGRTSDFIESREYEQPLNVYGYSKFLFDEYVRQVLPEANSQIVGFRYFNVYGPREGHKGS
MASVAFHLNTQLNNGESPKLFEGSDGFKRDFVYVGDVAAVNLWFWENGVSGIFNLGTGRA
ESFQAVADATLAYHKKGSIEYIPFPDKLKGRYQAFTQADLTNLRAAGYDKPFKTVAEGVT
EYMAWLNRDA